Lineage for d1nom_2 (1nom 149-335)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338199Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 338200Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) (S)
  5. 338208Family d.218.1.2: DNA polymerase beta-like [81300] (3 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 338209Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 338303Species Rat (Rattus norvegicus) [TaxId:10116] [81576] (17 PDB entries)
  8. 338317Domain d1nom_2: 1nom 149-335 [75930]
    Other proteins in same PDB: d1nom_1
    complexed with mn

Details for d1nom_2

PDB Entry: 1nom (more details), 3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of mncl2 (5 millimolar)

SCOP Domain Sequences for d1nom_2:

Sequence, based on SEQRES records: (download)

>d1nom_2 d.218.1.2 (149-335) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrse

Sequence, based on observed residues (ATOM records): (download)

>d1nom_2 d.218.1.2 (149-335) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepk
drse

SCOP Domain Coordinates for d1nom_2:

Click to download the PDB-style file with coordinates for d1nom_2.
(The format of our PDB-style files is described here.)

Timeline for d1nom_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nom_1