Lineage for d1l2ca3 (1l2c A:235-274)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750541Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 750542Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 750543Species Bacillus stearothermophilus [TaxId:1422] [81613] (9 PDB entries)
  8. 750548Domain d1l2ca3: 1l2c A:235-274 [75919]
    Other proteins in same PDB: d1l2ca1, d1l2ca2
    DNA estranged thymine mismatch recognition complex
    complexed with hpd, zn

Details for d1l2ca3

PDB Entry: 1l2c (more details), 2.2 Å

PDB Description: MutM (Fpg)-DNA Estranged Thymine Mismatch Recognition Complex
PDB Compounds: (A:) MutM

SCOP Domain Sequences for d1l2ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ca3 g.39.1.8 (A:235-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
fqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOP Domain Coordinates for d1l2ca3:

Click to download the PDB-style file with coordinates for d1l2ca3.
(The format of our PDB-style files is described here.)

Timeline for d1l2ca3: