Lineage for d1kyon2 (1kyo N:262-385)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888181Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 888182Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 888183Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 888184Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 888185Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (7 PDB entries)
  8. 888195Domain d1kyon2: 1kyo N:262-385 [75906]
    Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_
    complexed with fes, hem, m3l, sma

Details for d1kyon2

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c
PDB Compounds: (N:) cytochrome b

SCOP Domain Sequences for d1kyon2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyon2 f.32.1.1 (N:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOP Domain Coordinates for d1kyon2:

Click to download the PDB-style file with coordinates for d1kyon2.
(The format of our PDB-style files is described here.)

Timeline for d1kyon2: