Lineage for d1kqgb2 (1kqg B:246-290)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268311Superfamily f.23.22: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81597] (1 family) (S)
  5. 268312Family f.23.22.1: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81596] (1 protein)
  6. 268313Protein Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81595] (1 species)
  7. 268314Species Escherichia coli [TaxId:562] [81594] (2 PDB entries)
  8. 268316Domain d1kqgb2: 1kqg B:246-290 [75903]
    Other proteins in same PDB: d1kqga1, d1kqga2, d1kqgb1, d1kqgc_
    complexed with 6mo, cdl, cse, fs4, hem, hq, mgd

Details for d1kqgb2

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli

SCOP Domain Sequences for d1kqgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqgb2 f.23.22.1 (B:246-290) Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor {Escherichia coli}
idtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee

SCOP Domain Coordinates for d1kqgb2:

Click to download the PDB-style file with coordinates for d1kqgb2.
(The format of our PDB-style files is described here.)

Timeline for d1kqgb2: