Lineage for d1kqgb2 (1kqg B:246-290)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily f.23.22: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81597] (1 family) (S)
    automatically mapped to Pfam PF09163
  5. Family f.23.22.1: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81596] (1 protein)
  6. Protein Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81595] (1 species)
  7. Species Escherichia coli [TaxId:562] [81594] (2 PDB entries)
  8. Domain d1kqgb2: 1kqg B:246-290 [75903]
    Other proteins in same PDB: d1kqga1, d1kqga2, d1kqgb1, d1kqgc_
    complexed with 6mo, cdl, hem, hqo, mgd, sf4

Details for d1kqgb2

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli
PDB Compounds: (B:) formate dehydrogenase, nitrate-inducible, iron-sulfur subunit

SCOPe Domain Sequences for d1kqgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqgb2 f.23.22.1 (B:246-290) Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor {Escherichia coli [TaxId: 562]}
idtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee

SCOPe Domain Coordinates for d1kqgb2 are not available.

Timeline for d1kqgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kqgb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kqga1, d1kqga2, d1kqgc_