![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.22: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81597] (1 family) ![]() automatically mapped to Pfam PF09163 |
![]() | Family f.23.22.1: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81596] (1 protein) |
![]() | Protein Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81595] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [81594] (2 PDB entries) |
![]() | Domain d1kqgb2: 1kqg B:246-290 [75903] Other proteins in same PDB: d1kqga1, d1kqga2, d1kqgb1, d1kqgc_ complexed with 6mo, cdl, hem, hqo, mgd, sf4 |
PDB Entry: 1kqg (more details), 2.8 Å
SCOPe Domain Sequences for d1kqgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqgb2 f.23.22.1 (B:246-290) Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor {Escherichia coli [TaxId: 562]} idtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee
Timeline for d1kqgb2: