Lineage for d1kqfb2 (1kqf B:246-290)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026275Superfamily f.23.22: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81597] (1 family) (S)
    automatically mapped to Pfam PF09163
  5. 3026276Family f.23.22.1: Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81596] (1 protein)
  6. 3026277Protein Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor [81595] (1 species)
  7. 3026278Species Escherichia coli [TaxId:562] [81594] (2 PDB entries)
  8. 3026279Domain d1kqfb2: 1kqf B:246-290 [75901]
    Other proteins in same PDB: d1kqfa1, d1kqfa2, d1kqfb1, d1kqfc_
    complexed with 6mo, cdl, hem, mgd, sf4

Details for d1kqfb2

PDB Entry: 1kqf (more details), 1.6 Å

PDB Description: formate dehydrogenase n from e. coli
PDB Compounds: (B:) formate dehydrogenase, nitrate-inducible, iron-sulfur subunit

SCOPe Domain Sequences for d1kqfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqfb2 f.23.22.1 (B:246-290) Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor {Escherichia coli [TaxId: 562]}
idtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee

SCOPe Domain Coordinates for d1kqfb2:

Click to download the PDB-style file with coordinates for d1kqfb2.
(The format of our PDB-style files is described here.)

Timeline for d1kqfb2: