Lineage for d1knyb1 (1kny B:126-253)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1483413Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1484183Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 1484184Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (1 protein)
    N-terminal catalytic domain is followed by an all-alpha domain
    automatically mapped to Pfam PF07827
  6. 1484185Protein Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81591] (1 species)
  7. 1484186Species Staphylococcus aureus [TaxId:1280] [81590] (2 PDB entries)
  8. 1484188Domain d1knyb1: 1kny B:126-253 [75898]
    Other proteins in same PDB: d1knya2, d1knyb2
    complexed with apc, kan, mg

Details for d1knyb1

PDB Entry: 1kny (more details), 2.5 Å

PDB Description: kanamycin nucleotidyltransferase
PDB Compounds: (B:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d1knyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knyb1 a.24.16.1 (B:126-253) Kanamycin nucleotidyltransferase (KNTase), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
veaqtfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy
ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv
dvskripf

SCOPe Domain Coordinates for d1knyb1:

Click to download the PDB-style file with coordinates for d1knyb1.
(The format of our PDB-style files is described here.)

Timeline for d1knyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1knyb2