Lineage for d1kjua3 (1kju A:361-599)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423115Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; contains large bifurcated beta-sheet covered on both sides with helices and loops
  4. 423116Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 423117Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (2 proteins)
  6. 423118Protein Calcium ATPase [81658] (1 species)
  7. 423119Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (3 PDB entries)
  8. 423123Domain d1kjua3: 1kju A:361-599 [75894]
    Other proteins in same PDB: d1kjua1, d1kjua2, d1kjua4
    Structure in the e2 state

Details for d1kjua3

PDB Entry: 1kju (more details), 6 Å

PDB Description: ca2+-atpase in the e2 state

SCOP Domain Sequences for d1kjua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjua3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus)}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOP Domain Coordinates for d1kjua3:

Click to download the PDB-style file with coordinates for d1kjua3.
(The format of our PDB-style files is described here.)

Timeline for d1kjua3: