SCOP 1.67: Domain d1kjua1: 1kju A:125-239

Lineage for d1kjua1 (1kju A:125-239)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (3 PDB entries)

8. Domain d1kjua1: 1kju A:125-239 [75892]
   Other proteins in same PDB: d1kjua2, d1kjua3, d1kjua4
   Structure in the e2 state

Details for d1kjua1

PDB Entry: 1kju, 6 Å

PDB Description: ca2+-atpase in the e2 state

SCOP Domain Sequences for d1kjua1:

Sequence; same for both SEQRES and ATOM records:

>d1kjua1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d1kjua1:

• d1kjua1 first appeared in SCOP 1.63
  
• d1kjua1 appears in SCOP 1.65
  
• d1kjua1 appears in SCOP 1.69
  
• d1kjua1 appears in the current release, SCOPe 2.08