Lineage for d1kfvb3 (1kfv B:229-271)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271116Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 271117Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) (S)
  5. 271247Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (2 proteins)
  6. 271248Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 271260Species Lactococcus lactis [TaxId:1358] [81619] (2 PDB entries)
  8. 271263Domain d1kfvb3: 1kfv B:229-271 [75891]
    Other proteins in same PDB: d1kfva1, d1kfva2, d1kfvb1, d1kfvb2
    complexed with cry, mse, pdi, zn; mutant

Details for d1kfvb3

PDB Entry: 1kfv (more details), 2.55 Å

PDB Description: Crystal Structure of Lactococcus lactis Formamido-pyrimidine DNA Glycosylase (alias Fpg or MutM) Non Covalently Bound to an AP Site Containing DNA.

SCOP Domain Sequences for d1kfvb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfvb3 g.39.1.8 (B:229-271) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOP Domain Coordinates for d1kfvb3:

Click to download the PDB-style file with coordinates for d1kfvb3.
(The format of our PDB-style files is described here.)

Timeline for d1kfvb3: