Lineage for d1kfva2 (1kfv A:1-131)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569023Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 569024Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 569025Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 569026Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 569040Species Lactococcus lactis [TaxId:1358] [81617] (6 PDB entries)
  8. 569046Domain d1kfva2: 1kfv A:1-131 [75887]
    Other proteins in same PDB: d1kfva1, d1kfva3, d1kfvb1, d1kfvb3

Details for d1kfva2

PDB Entry: 1kfv (more details), 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.

SCOP Domain Sequences for d1kfva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfva2 b.113.1.1 (A:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

SCOP Domain Coordinates for d1kfva2:

Click to download the PDB-style file with coordinates for d1kfva2.
(The format of our PDB-style files is described here.)

Timeline for d1kfva2: