Lineage for d1keja4 (1kej A:303-510)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446207Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1446208Superfamily d.218.1: Nucleotidyltransferase [81301] (15 families) (S)
  5. 1446216Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1446410Protein Terminal deoxynucleotidyl transferase [81581] (1 species)
  7. 1446411Species Mouse (Mus musculus) [TaxId:10090] [81580] (3 PDB entries)
  8. 1446414Domain d1keja4: 1kej A:303-510 [75885]
    Other proteins in same PDB: d1keja1, d1keja3
    complexed with co, dad, na

Details for d1keja4

PDB Entry: 1kej (more details), 3 Å

PDB Description: Crystal Structure of Murine Terminal Deoxynucleotidyl Transferase complexed with ddATP
PDB Compounds: (A:) Terminal deoxynucleotidyltransferase short isoform

SCOPe Domain Sequences for d1keja4:

Sequence, based on SEQRES records: (download)

>d1keja4 d.218.1.2 (A:303-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d1keja4 d.218.1.2 (A:303-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfeqpsrkvdaldhfqkcflilkldhgrvhseksegkgw
kairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvflea
eseeeifahlgldyiepwerna

SCOPe Domain Coordinates for d1keja4:

Click to download the PDB-style file with coordinates for d1keja4.
(The format of our PDB-style files is described here.)

Timeline for d1keja4: