SCOPe 2.04: Domain d1kdha3: 1kdh A:243-302

Lineage for d1kdha3 (1kdh A:243-302)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein Terminal deoxynucleotidyl transferase [81583] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries)

8. Domain d1kdha3: 1kdh A:243-302 [75882]
   Other proteins in same PDB: d1kdha1, d1kdha4
   protein/DNA complex; complexed with mg, na

Details for d1kdha3

PDB Entry: 1kdh, 3 Å

PDB Description: binary complex of murine terminal deoxynucleotidyl transferase with a primer single stranded dna

PDB Compounds: (A:) Terminal deoxynucleotidyltransferase short isoform

SCOPe Domain Sequences for d1kdha3:

Sequence; same for both SEQRES and ATOM records:

>d1kdha3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

Timeline for d1kdha3:

• d1kdha3 first appeared in SCOP 1.63
  
• d1kdha3 appears in SCOPe 2.03
  
• d1kdha3 appears in SCOPe 2.05
  
• d1kdha3 appears in the current release, SCOPe 2.08