SCOP 1.65: Domain d1kdha3: 1kdh A:243-302

Lineage for d1kdha3 (1kdh A:243-302)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
   topological similarity to the N-terminal domain

6. Protein Terminal deoxynucleotidyl transferase [81583] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries)

8. Domain d1kdha3: 1kdh A:243-302 [75882]
   Other proteins in same PDB: d1kdha1, d1kdha4
   complexed with bro, mg, na

Details for d1kdha3

PDB Entry: 1kdh, 3 Å

PDB Description: binary complex of murine terminal deoxynucleotidyl transferase with a primer single stranded dna

SCOP Domain Sequences for d1kdha3:

Sequence; same for both SEQRES and ATOM records:

>d1kdha3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

Timeline for d1kdha3:

• d1kdha3 first appeared in SCOP 1.63
  
• d1kdha3 appears in SCOP 1.67
  
• d1kdha3 appears in the current release, SCOPe 2.08