Class a: All alpha proteins [46456] (171 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins) topological similarity to the N-terminal domain |
Protein Terminal deoxynucleotidyl transferase [81583] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries) |
Domain d1kdha3: 1kdh A:243-302 [75882] Other proteins in same PDB: d1kdha1, d1kdha4 complexed with bro, mg, na |
PDB Entry: 1kdh (more details), 3 Å
SCOP Domain Sequences for d1kdha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdha3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)} deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
Timeline for d1kdha3: