Lineage for d1kanb2 (1kan B:1-125)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265789Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 265790Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) (S)
  5. 265791Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (1 protein)
    insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243
  6. 265792Protein Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56709] (1 species)
  7. 265793Species Staphylococcus aureus [TaxId:1280] [56710] (2 PDB entries)
  8. 265797Domain d1kanb2: 1kan B:1-125 [75881]
    Other proteins in same PDB: d1kana1, d1kanb1
    CA-atoms only, mutant protein sequence

Details for d1kanb2

PDB Entry: 1kan (more details), 3 Å

PDB Description: molecular structure of kanamycin nucleotidyltransferase determined to 3.0-angstroms resolution

SCOP Domain Sequences for d1kanb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kanb2 d.218.1.1 (B:1-125) Kanamycin nucleotidyltransferase (KNTase), N-terminal domain {Staphylococcus aureus}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfyseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaks

SCOP Domain Coordinates for d1kanb2:

Click to download the PDB-style file with coordinates for d1kanb2.
(The format of our PDB-style files is described here.)

Timeline for d1kanb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kanb1