Lineage for d1kanb1 (1kan B:126-253)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211870Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 212150Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (2 families) (S)
  5. 212151Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (1 protein)
    N-terminal catalytic domain is followed by an all-alpha domain
  6. 212152Protein Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81591] (1 species)
  7. 212153Species Staphylococcus aureus [TaxId:1280] [81590] (2 PDB entries)
  8. 212157Domain d1kanb1: 1kan B:126-253 [75880]
    Other proteins in same PDB: d1kana2, d1kanb2
    CA-atoms only, mutant protein sequence

Details for d1kanb1

PDB Entry: 1kan (more details), 3 Å

PDB Description: molecular structure of kanamycin nucleotidyltransferase determined to 3.0-angstroms resolution

SCOP Domain Sequences for d1kanb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kanb1 a.24.16.1 (B:126-253) Kanamycin nucleotidyltransferase (KNTase), C-terminal domain {Staphylococcus aureus}
veaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy
ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv
dvskripf

SCOP Domain Coordinates for d1kanb1:

Click to download the PDB-style file with coordinates for d1kanb1.
(The format of our PDB-style files is described here.)

Timeline for d1kanb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kanb2