Lineage for d1jmsa3 (1jms A:243-302)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 357148Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 357149Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 357271Protein Terminal deoxynucleotidyl transferase [81583] (1 species)
  7. 357272Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries)
  8. 357273Domain d1jmsa3: 1jms A:243-302 [75862]
    Other proteins in same PDB: d1jmsa1, d1jmsa4
    complexed with mg, na

Details for d1jmsa3

PDB Entry: 1jms (more details), 2.36 Å

PDB Description: Crystal Structure of the Catalytic Core of Murine Terminal Deoxynucleotidyl Transferase

SCOP Domain Sequences for d1jmsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOP Domain Coordinates for d1jmsa3:

Click to download the PDB-style file with coordinates for d1jmsa3.
(The format of our PDB-style files is described here.)

Timeline for d1jmsa3: