Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; contains large bifurcated beta-sheet covered on both sides with helices and loops |
Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) |
Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (2 proteins) |
Protein Calcium ATPase [81658] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (3 PDB entries) |
Domain d1iwob3: 1iwo B:361-599 [75860] Other proteins in same PDB: d1iwoa1, d1iwoa2, d1iwoa4, d1iwob1, d1iwob2, d1iwob4 Structure in the absence of calcium ions complexed with tg1 |
PDB Entry: 1iwo (more details), 3.1 Å
SCOP Domain Sequences for d1iwob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwob3 d.220.1.1 (B:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus)} msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d1iwob3:
View in 3D Domains from other chains: (mouse over for more information) d1iwoa1, d1iwoa2, d1iwoa3, d1iwoa4 |