Lineage for d1iwob3 (1iwo B:361-599)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265945Fold d.220: Calcium ATPase, ATP-binding domain N [81661] (1 superfamily)
  4. 265946Superfamily d.220.1: Calcium ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 265947Family d.220.1.1: Calcium ATPase, ATP-binding domain N [81659] (1 protein)
  6. 265948Protein Calcium ATPase, ATP-binding domain N [81658] (1 species)
  7. 265949Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (3 PDB entries)
  8. 265952Domain d1iwob3: 1iwo B:361-599 [75860]
    Other proteins in same PDB: d1iwoa1, d1iwoa2, d1iwoa4, d1iwob1, d1iwob2, d1iwob4
    Structure in the absence of calcium ions
    complexed with tg1

Details for d1iwob3

PDB Entry: 1iwo (more details), 3.1 Å

PDB Description: Crystal structure of the SR Ca2+-ATPase in the absence of Ca2+

SCOP Domain Sequences for d1iwob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwob3 d.220.1.1 (B:361-599) Calcium ATPase, ATP-binding domain N {Rabbit (Oryctolagus cuniculus)}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOP Domain Coordinates for d1iwob3:

Click to download the PDB-style file with coordinates for d1iwob3.
(The format of our PDB-style files is described here.)

Timeline for d1iwob3: