Lineage for d1iwoa4 (1iwo A:1-124,A:240-343,A:751-994)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 341260Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 341261Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 341262Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 341263Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 341264Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (3 PDB entries)
  8. 341266Domain d1iwoa4: 1iwo A:1-124,A:240-343,A:751-994 [75857]
    Other proteins in same PDB: d1iwoa1, d1iwoa2, d1iwoa3, d1iwob1, d1iwob2, d1iwob3

Details for d1iwoa4

PDB Entry: 1iwo (more details), 3.1 Å

PDB Description: Crystal structure of the SR Ca2+-ATPase in the absence of Ca2+

SCOP Domain Sequences for d1iwoa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwoa4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus)}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOP Domain Coordinates for d1iwoa4:

Click to download the PDB-style file with coordinates for d1iwoa4.
(The format of our PDB-style files is described here.)

Timeline for d1iwoa4: