SCOPe 2.05: Domain d1huza3: 1huz A:92-148

Lineage for d1huza3 (1huz A:92-148)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)

8. Domain d1huza3: 1huz A:92-148 [75850]
   Other proteins in same PDB: d1huza1, d1huza4, d1huzb1, d1huzb4
   protein/DNA complex; complexed with cr, mdn

Details for d1huza3

PDB Entry: 1huz, 2.6 Å

PDB Description: crystal structure of dna polymerase complexed with dna and cr-pcp

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1huza3:

Sequence; same for both SEQRES and ATOM records:

>d1huza3 a.60.12.1 (A:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d1huza3:

• d1huza3 first appeared in SCOP 1.63
  
• d1huza3 appears in SCOPe 2.04
  
• d1huza3 appears in SCOPe 2.06
  
• d1huza3 appears in the current release, SCOPe 2.08