Lineage for d1huoa3 (1huo A:92-148)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 357148Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 357149Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 357150Protein DNA polymerase beta [81579] (2 species)
  7. 357244Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)
  8. 357250Domain d1huoa3: 1huo A:92-148 [75846]
    Other proteins in same PDB: d1huoa1, d1huoa4, d1huob1, d1huob4

Details for d1huoa3

PDB Entry: 1huo (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp

SCOP Domain Sequences for d1huoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huoa3 a.60.12.1 (A:92-148) DNA polymerase beta {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOP Domain Coordinates for d1huoa3:

Click to download the PDB-style file with coordinates for d1huoa3.
(The format of our PDB-style files is described here.)

Timeline for d1huoa3: