SCOPe 2.08: Domain d1huoa3: 1huo A:92-148

Lineage for d1huoa3 (1huo A:92-148)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)

8. Domain d1huoa3: 1huo A:92-148 [75846]
   Other proteins in same PDB: d1huoa1, d1huoa4, d1huob1, d1huob4
   protein/DNA complex; complexed with cr, tte

Details for d1huoa3

PDB Entry: 1huo, 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1huoa3:

Sequence; same for both SEQRES and ATOM records:

>d1huoa3 a.60.12.1 (A:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d1huoa3:

• d1huoa3 first appeared in SCOP 1.63
  
• d1huoa3 appears in SCOPe 2.07