Lineage for d1fnoa4 (1fno A:1-207,A:321-408)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246616Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 246767Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 246852Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (4 proteins)
  6. 246875Protein Peptidase T (tripeptidase) [75250] (1 species)
  7. 246876Species Salmonella typhimurium [TaxId:90371] [75251] (1 PDB entry)
  8. 246877Domain d1fnoa4: 1fno A:1-207,A:321-408 [75841]
    Other proteins in same PDB: d1fnoa3
    complexed with mse, so4, zn2

Details for d1fnoa4

PDB Entry: 1fno (more details), 2.4 Å

PDB Description: peptidase t (tripeptidase)

SCOP Domain Sequences for d1fnoa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnoa4 c.56.5.4 (A:1-207,A:321-408) Peptidase T (tripeptidase) {Salmonella typhimurium}
mdkllerflhyvsldtqsksgvrqvpstegqwkllrllkqqleemglvnitlsekgtlma
tlpanvegdipaigfishvdtspdfsgknvnpqivenyrggdialgigdevlspvmfpvl
hqllgqtlittdgktllgaddkagvaeimtalavlkgnpiphgdikvaftpdeevgkgak
hfdveafgaqwaytvdgggvgelefenXnmrekvvehphildiaqqamrdchitpemkpi
rggtdgaqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltakrg

SCOP Domain Coordinates for d1fnoa4:

Click to download the PDB-style file with coordinates for d1fnoa4.
(The format of our PDB-style files is described here.)

Timeline for d1fnoa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnoa3