Class a: All alpha proteins [46456] (286 folds) |
Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) this domain follows the catalytic nucleotidyltransferase domain |
Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein) |
Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (5 PDB entries) |
Domain d1fa0b3: 1fa0 B:202-351 [75839] Other proteins in same PDB: d1fa0a1, d1fa0a4, d1fa0b1, d1fa0b4 complexed with 3ad, 3at, mn, pop |
PDB Entry: 1fa0 (more details), 2.6 Å
SCOPe Domain Sequences for d1fa0b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fa0b3 a.160.1.1 (B:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk kvilqefvrgvqitndifsnkkswanlfek
Timeline for d1fa0b3: