SCOPe 2.04: Domain d1f5aa3: 1f5a A:215-364

Lineage for d1f5aa3 (1f5a A:215-364)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)

6. Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56707] (3 PDB entries)
   Uniprot P25500 18-497

8. Domain d1f5aa3: 1f5a A:215-364 [75835]
   Other proteins in same PDB: d1f5aa1, d1f5aa4
   complexed with 3at, 3po, mn

Details for d1f5aa3

PDB Entry: 1f5a, 2.5 Å

PDB Description: crystal structure of mammalian poly(a) polymerase

PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d1f5aa3:

Sequence; same for both SEQRES and ATOM records:

>d1f5aa3 a.160.1.1 (A:215-364) Poly(A) polymerase, PAP, middle domain {Cow (Bos taurus) [TaxId: 9913]}
pnidnfrltlraiklwakrhniysnilgflggvswamlvartcqlypnaiastlvhkffl
vfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvsvstr
mvmveefkqglaitdeillskaewsklfea

Timeline for d1f5aa3:

• d1f5aa3 first appeared in SCOP 1.63
  
• d1f5aa3 appears in SCOPe 2.03
  
• d1f5aa3 appears in SCOPe 2.05
  
• d1f5aa3 appears in the current release, SCOPe 2.08