Lineage for d1ezvc3 (1ezv C:1-261)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620137Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 620138Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 620144Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 620151Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 620152Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81640] (4 PDB entries)
  8. 620154Domain d1ezvc3: 1ezv C:1-261 [75834]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
    complexed with fes, hem, sma, uq6

Details for d1ezvc3

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvc3 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

SCOP Domain Coordinates for d1ezvc3:

Click to download the PDB-style file with coordinates for d1ezvc3.
(The format of our PDB-style files is described here.)

Timeline for d1ezvc3: