Lineage for d1eula3 (1eul A:361-599)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265945Fold d.220: Calcium ATPase, ATP-binding domain N [81661] (1 superfamily)
  4. 265946Superfamily d.220.1: Calcium ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 265947Family d.220.1.1: Calcium ATPase, ATP-binding domain N [81659] (1 protein)
  6. 265948Protein Calcium ATPase, ATP-binding domain N [81658] (1 species)
  7. 265949Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (3 PDB entries)
  8. 265950Domain d1eula3: 1eul A:361-599 [75831]
    Other proteins in same PDB: d1eula1, d1eula2, d1eula4
    complexed with ca

Details for d1eula3

PDB Entry: 1eul (more details), 2.6 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions

SCOP Domain Sequences for d1eula3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eula3 d.220.1.1 (A:361-599) Calcium ATPase, ATP-binding domain N {Rabbit (Oryctolagus cuniculus)}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOP Domain Coordinates for d1eula3:

Click to download the PDB-style file with coordinates for d1eula3.
(The format of our PDB-style files is described here.)

Timeline for d1eula3: