Lineage for d1eula2 (1eul A:344-360,A:600-750)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322675Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 322676Superfamily c.108.1: HAD-like [56784] (10 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 322759Family c.108.1.7: Calcium ATPase, catalytic domain P [81656] (1 protein)
    interrupted by a large insertion, domain N
  6. 322760Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 322761Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (3 PDB entries)
  8. 322762Domain d1eula2: 1eul A:344-360,A:600-750 [75830]
    Other proteins in same PDB: d1eula1, d1eula3, d1eula4
    complexed with ca

Details for d1eula2

PDB Entry: 1eul (more details), 2.6 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions

SCOP Domain Sequences for d1eula2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eula2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus)}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOP Domain Coordinates for d1eula2:

Click to download the PDB-style file with coordinates for d1eula2.
(The format of our PDB-style files is described here.)

Timeline for d1eula2: