Lineage for d1eula1 (1eul A:125-239)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234509Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 234855Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 234856Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 234857Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 234858Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (3 PDB entries)
  8. 234859Domain d1eula1: 1eul A:125-239 [75829]
    Other proteins in same PDB: d1eula2, d1eula3, d1eula4
    complexed with ca

Details for d1eula1

PDB Entry: 1eul (more details), 2.6 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions

SCOP Domain Sequences for d1eula1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eula1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOP Domain Coordinates for d1eula1:

Click to download the PDB-style file with coordinates for d1eula1.
(The format of our PDB-style files is described here.)

Timeline for d1eula1: