Lineage for d1bpxa3 (1bpx A:92-148)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001966Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001967Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2001968Protein DNA polymerase beta [81579] (2 species)
  7. 2001969Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)
  8. 2002094Domain d1bpxa3: 1bpx A:92-148 [75817]
    Other proteins in same PDB: d1bpxa1, d1bpxa4
    protein/DNA complex; complexed with na

Details for d1bpxa3

PDB Entry: 1bpx (more details), 2.4 Å

PDB Description: dna polymerase beta/dna complex
PDB Compounds: (A:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d1bpxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpxa3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d1bpxa3:

Click to download the PDB-style file with coordinates for d1bpxa3.
(The format of our PDB-style files is described here.)

Timeline for d1bpxa3: