Lineage for d1bpea2 (1bpe A:92-148)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494216Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1494217Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1494218Protein DNA polymerase beta [81579] (2 species)
  7. 1494363Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)
  8. 1494392Domain d1bpea2: 1bpe A:92-148 [75815]
    Other proteins in same PDB: d1bpea1, d1bpea3
    complexed with dtp

Details for d1bpea2

PDB Entry: 1bpe (more details), 2.9 Å

PDB Description: crystal structure of rat dna polymerase beta; evidence for a common polymerase mechanism
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1bpea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpea2 a.60.12.1 (A:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOPe Domain Coordinates for d1bpea2:

Click to download the PDB-style file with coordinates for d1bpea2.
(The format of our PDB-style files is described here.)

Timeline for d1bpea2: