SCOP 1.63: Domain d1bpb_1: 1bpb 91-148

Lineage for d1bpb_1 (1bpb 91-148)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)

8. Domain d1bpb_1: 1bpb 91-148 [75811]
   Other proteins in same PDB: d1bpb_2

Details for d1bpb_1

PDB Entry: 1bpb, 2.3 Å

PDB Description: crystal structure of rat dna polymerase beta: evidence for a common polymerase mechanism

SCOP Domain Sequences for d1bpb_1:

Sequence; same for both SEQRES and ATOM records:

>d1bpb_1 a.60.12.1 (91-148) DNA polymerase beta {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d1bpb_1:

• d1bpb_1 is new in SCOP 1.63
  
• d1bpb_1 appears in SCOP 1.65
  
• d1bpb_1 appears in the current release, SCOPe 2.08, called d1bpba1