Lineage for d1bgyo2 (1bgy O:261-379)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 341239Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 341240Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 341241Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (1 protein)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 341242Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 341253Species Cow (Bos taurus) [TaxId:9913] [81643] (5 PDB entries)
  8. 341259Domain d1bgyo2: 1bgy O:261-379 [75809]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyv_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgyo2

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyo2 f.32.1.1 (O:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus)}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOP Domain Coordinates for d1bgyo2:

Click to download the PDB-style file with coordinates for d1bgyo2.
(The format of our PDB-style files is described here.)

Timeline for d1bgyo2: