Lineage for d1bgyc3 (1bgy C:1-260)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887002Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 887003Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 887009Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 887021Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 887039Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries)
    Uniprot P00157
  8. 887057Domain d1bgyc3: 1bgy C:1-260 [75808]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyv_, d1bgyw_

Details for d1bgyc3

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (C:) cytochrome bc1 complex

SCOP Domain Sequences for d1bgyc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyc3 f.21.1.2 (C:1-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
llvlfapdllgdpdnytpan

SCOP Domain Coordinates for d1bgyc3:

Click to download the PDB-style file with coordinates for d1bgyc3.
(The format of our PDB-style files is described here.)

Timeline for d1bgyc3: