Lineage for d1bccc3 (1bcc C:2-261)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456466Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1456467Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 1456473Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1456485Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 1456497Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)
  8. 1456506Domain d1bccc3: 1bcc C:2-261 [75804]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
    complexed with bog, fes, hem, pee, u10

Details for d1bccc3

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (C:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bccc3 f.21.1.2 (C:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

SCOPe Domain Coordinates for d1bccc3:

Click to download the PDB-style file with coordinates for d1bccc3.
(The format of our PDB-style files is described here.)

Timeline for d1bccc3: