SCOPe 2.08: Domain d1bccc3: 1bcc C:2-261

Lineage for d1bccc3 (1bcc C:2-261)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)

8. Domain d1bccc3: 1bcc C:2-261 [75804]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
   complexed with bog, fes, hem, pee, u10

Details for d1bccc3

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (C:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccc3:

Sequence; same for both SEQRES and ATOM records:

>d1bccc3 f.21.1.2 (C:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

Timeline for d1bccc3:

• d1bccc3 first appeared in SCOP 1.63
  
• d1bccc3 appears in SCOPe 2.07