Lineage for d1a6q_2 (1a6q 2-296)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265939Fold d.219: Protein serine/threonine phosphatase 2C, catalytic domain [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 265940Superfamily d.219.1: Protein serine/threonine phosphatase 2C, catalytic domain [81606] (1 family) (S)
    contain binuclear metal (Mn) centre
  5. 265941Family d.219.1.1: Protein serine/threonine phosphatase 2C, catalytic domain [81605] (1 protein)
  6. 265942Protein Protein serine/threonine phosphatase 2C, catalytic domain [81604] (1 species)
  7. 265943Species Human (Homo sapiens) [TaxId:9606] [81603] (1 PDB entry)
  8. 265944Domain d1a6q_2: 1a6q 2-296 [75802]
    Other proteins in same PDB: d1a6q_1
    complexed with mn, po4

Details for d1a6q_2

PDB Entry: 1a6q (more details), 2 Å

PDB Description: crystal structure of the protein serine/threonine phosphatase 2c at 2 a resolution

SCOP Domain Sequences for d1a6q_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6q_2 d.219.1.1 (2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens)}
gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapk

SCOP Domain Coordinates for d1a6q_2:

Click to download the PDB-style file with coordinates for d1a6q_2.
(The format of our PDB-style files is described here.)

Timeline for d1a6q_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6q_1