Lineage for d1a6q_1 (1a6q 297-368)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218741Fold a.159: Another 3-helical bundle [81602] (2 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 218742Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (1 family) (S)
    contain binuclear metal (Mn) centre
  5. 218743Family a.159.1.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81600] (1 protein)
  6. 218744Protein Protein serine/threonine phosphatase 2C, C-terminal domain [81599] (1 species)
  7. 218745Species Human (Homo sapiens) [TaxId:9606] [81598] (1 PDB entry)
  8. 218746Domain d1a6q_1: 1a6q 297-368 [75801]
    Other proteins in same PDB: d1a6q_2
    complexed with mn, po4

Details for d1a6q_1

PDB Entry: 1a6q (more details), 2 Å

PDB Description: crystal structure of the protein serine/threonine phosphatase 2c at 2 a resolution

SCOP Domain Sequences for d1a6q_1:

Sequence, based on SEQRES records: (download)

>d1a6q_1 a.159.1.1 (297-368) Protein serine/threonine phosphatase 2C, C-terminal domain {Human (Homo sapiens)}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records): (download)

>d1a6q_1 a.159.1.1 (297-368) Protein serine/threonine phosphatase 2C, C-terminal domain {Human (Homo sapiens)}
vspeavkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnviea
vynrlnpy

SCOP Domain Coordinates for d1a6q_1:

Click to download the PDB-style file with coordinates for d1a6q_1.
(The format of our PDB-style files is described here.)

Timeline for d1a6q_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6q_2