SCOPe 2.05: Domain d1md3a2: 1md3 A:2-76

Lineage for d1md3a2 (1md3 A:2-76)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)

8. Domain d1md3a2: 1md3 A:2-76 [74629]
   Other proteins in same PDB: d1md3a1, d1md3b1
   complexed with gsh, mes; mutant

Details for d1md3a2

PDB Entry: 1md3, 2.03 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to alanine

PDB Compounds: (A:) pi glutathione transferase

SCOPe Domain Sequences for d1md3a2:

Sequence; same for both SEQRES and ATOM records:

>d1md3a2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d1md3a2:

• d1md3a2 first appeared in SCOP 1.61
  
• d1md3a2 appears in SCOPe 2.04
  
• d1md3a2 appears in SCOPe 2.06
  
• d1md3a2 appears in the current release, SCOPe 2.08