Lineage for d1mc6a_ (1mc6 A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202677Superfamily g.3.5: Agouti-related protein [57055] (1 family) (S)
  5. 202678Family g.3.5.1: Agouti-related protein [57056] (1 protein)
  6. 202679Protein Agouti-related protein [57057] (1 species)
  7. 202680Species Synthetic, based on Homo sapiens sequence [57058] (2 PDB entries)
  8. 202682Domain d1mc6a_: 1mc6 A: [74623]

Details for d1mc6a_

PDB Entry: 1mc6 (more details)

PDB Description: Solution NMR Structure of AGRP(87-120; C105A)

SCOP Domain Sequences for d1mc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc6a_ g.3.5.1 (A:) Agouti-related protein {Synthetic, based on Homo sapiens sequence}
cvrlhesclgqqvpccdpaatcycrffnafcycr

SCOP Domain Coordinates for d1mc6a_:

Click to download the PDB-style file with coordinates for d1mc6a_.
(The format of our PDB-style files is described here.)

Timeline for d1mc6a_:

  • d1mc6a_ is new in SCOP 1.61
  • d1mc6a_ became obsolete in SCOP 1.63