SCOPe 2.08: Domain d1ma0a1: 1ma0 A:1-162,A:339-373

Lineage for d1ma0a1 (1ma0 A:1-162,A:339-373)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1ma0a1: 1ma0 A:1-162,A:339-373 [74605]
   Other proteins in same PDB: d1ma0a2, d1ma0b2
   glutathione-dependent formaldehyde dehydrogenase
   complexed with dao, k, nad, po4, zn

Details for d1ma0a1

PDB Entry: 1ma0, 2.3 Å

PDB Description: Ternary complex of Human glutathione-dependent formaldehyde dehydrogenase with NAD+ and dodecanoic acid

PDB Compounds: (A:) Glutathione-dependent formaldehyde dehydrogenase

SCOPe Domain Sequences for d1ma0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ma0a1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplXikvdefvthnlsfdein
kafelmhsgksirtvvki

Timeline for d1ma0a1:

• d1ma0a1 first appeared in SCOP 1.61
  
• d1ma0a1 appears in SCOPe 2.07