Lineage for d1m6vg4 (1m6v G:556-676)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482937Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 482938Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 482939Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)
  6. 482950Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 482951Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
  8. 482991Domain d1m6vg4: 1m6v G:556-676 [74563]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va5, d1m6va6, d1m6vb1, d1m6vb2, d1m6vc1, d1m6vc2, d1m6vc5, d1m6vc6, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve2, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg2, d1m6vg5, d1m6vg6, d1m6vh1, d1m6vh2

Details for d1m6vg4

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase

SCOP Domain Sequences for d1m6vg4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6vg4 c.30.1.1 (G:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1m6vg4:

Click to download the PDB-style file with coordinates for d1m6vg4.
(The format of our PDB-style files is described here.)

Timeline for d1m6vg4: