Lineage for d1m6vc1 (1m6v C:403-555)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154796Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
  4. 154797Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 154798Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 154799Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 154800Species Escherichia coli [TaxId:562] [48111] (9 PDB entries)
  8. 154834Domain d1m6vc1: 1m6v C:403-555 [74544]
    Other proteins in same PDB: d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb1, d1m6vb2, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6vd2, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vf2, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1, d1m6vh2

Details for d1m6vc1

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase

SCOP Domain Sequences for d1m6vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6vc1 a.92.1.1 (C:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1m6vc1:

Click to download the PDB-style file with coordinates for d1m6vc1.
(The format of our PDB-style files is described here.)

Timeline for d1m6vc1: