Lineage for d1m6ha1 (1m6h A:1-162,A:339-373)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 797353Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 797474Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 797492Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 797598Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326
    Uniprot P00325
    Uniprot P07327
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 797609Domain d1m6ha1: 1m6h A:1-162,A:339-373 [74529]
    Other proteins in same PDB: d1m6ha2, d1m6hb2
    glutathione-dependent formaldehyde dehydrogenase

Details for d1m6ha1

PDB Entry: 1m6h (more details), 2 Å

PDB Description: Human glutathione-dependent formaldehyde dehydrogenase
PDB Compounds: (A:) Glutathione-dependent formaldehyde dehydrogenase

SCOP Domain Sequences for d1m6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ha1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplXikvdefvthnlsfdein
kafelmhsgksirtvvki

SCOP Domain Coordinates for d1m6ha1:

Click to download the PDB-style file with coordinates for d1m6ha1.
(The format of our PDB-style files is described here.)

Timeline for d1m6ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m6ha2