Lineage for d1m6ba4 (1m6b A:480-580)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202955Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 202956Family g.3.9.1: Growth factor receptor domain [57185] (3 proteins)
  6. 202961Protein Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains [75668] (1 species)
  7. 202962Species Human (Homo sapiens) [TaxId:9606] [75669] (1 PDB entry)
  8. 202964Domain d1m6ba4: 1m6b A:480-580 [74524]
    Other proteins in same PDB: d1m6ba1, d1m6ba2, d1m6bb1, d1m6bb2

Details for d1m6ba4

PDB Entry: 1m6b (more details), 2.6 Å

PDB Description: structure of the her3 (erbb3) extracellular domain

SCOP Domain Sequences for d1m6ba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ba4 g.3.9.1 (A:480-580) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens)}
vcdplcssggcwgpgpgqclscrnysrggvcvthcnflngeprefaheaecfschpecqp
megtatcngsgsdtcaqcahfrdgphcvsscphgvlgakgp

SCOP Domain Coordinates for d1m6ba4:

Click to download the PDB-style file with coordinates for d1m6ba4.
(The format of our PDB-style files is described here.)

Timeline for d1m6ba4: