Lineage for d1m6ba1 (1m6b A:8-165)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851793Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2851834Protein Receptor protein-tyrosine kinase Erbb-3 extracellular domain [75145] (1 species)
  7. 2851835Species Human (Homo sapiens) [TaxId:9606] [75146] (1 PDB entry)
  8. 2851836Domain d1m6ba1: 1m6b A:8-165 [74521]
    Other proteins in same PDB: d1m6ba3, d1m6ba4, d1m6bb3, d1m6bb4
    L1 and L2 domains
    complexed with nag, so4

Details for d1m6ba1

PDB Entry: 1m6b (more details), 2.6 Å

PDB Description: structure of the her3 (erbb3) extracellular domain
PDB Compounds: (A:) Receptor protein-tyrosine kinase erbB-3

SCOPe Domain Sequences for d1m6ba1:

Sequence, based on SEQRES records: (download)

>d1m6ba1 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
avcpgtlnglsvtgdaenqyqtlyklyercevvmgnleivltghnadlsflqwvrevtgy
vlvamnefstlplpnlrvvrgtqvydgkfaifvmlnyntnsshalrqlrltqlteilsgg
vyiekndklchmdtidwrdivrdrdaeivvkdngrscp

Sequence, based on observed residues (ATOM records): (download)

>d1m6ba1 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
avcprcevvmgnleivltghnadlsflqwvrevtgyvlvamnefstlplpnlrvvrgtqv
ydgkfaifvmlnyntnsshalrqlrltqlteilsggvyiekndklchmdtidwrdivrdr
daeivvkdngrscp

SCOPe Domain Coordinates for d1m6ba1:

Click to download the PDB-style file with coordinates for d1m6ba1.
(The format of our PDB-style files is described here.)

Timeline for d1m6ba1: