Lineage for d1m5kf_ (1m5k F:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) 
Protein Splicesomal U1A protein [54932] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries) 
Domain d1m5kf_: 1m5k F: [74510]
Details for d1m5kf_
PDB Entry: 1m5k (more details), 2.4 Å
PDB Description: crystal structure of a hairpin ribozyme in the catalytically-active conformation
SCOP Domain Sequences for d1m5kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5kf_ d.58.7.1 (F:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakm
SCOP Domain Coordinates for d1m5kf_:
Click to download the PDB-style file with coordinates for d1m5kf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m5kf_:
- d1m5kf_ is new in SCOP 1.61
- d1m5kf_ appears in SCOP 1.63
- d1m5kf_ appears in the current release, SCOPe 2.08
View in 3D
