SCOPe 2.06: Domain d1m5kc_: 1m5k C:

Lineage for d1m5kc_ (1m5k C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (50 PDB entries)
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d1m5kc_: 1m5k C: [74509]
   domain 1, complex with a hairpin ribozyme
   protein/RNA complex; complexed with ca, cl

Details for d1m5kc_

PDB Entry: 1m5k, 2.4 Å

PDB Description: crystal structure of a hairpin ribozyme in the catalytically-active conformation

PDB Compounds: (C:) protein (u1 small nuclear ribonucleoprotein a)

SCOPe Domain Sequences for d1m5kc_:

Sequence; same for both SEQRES and ATOM records:

>d1m5kc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakm

Timeline for d1m5kc_:

• d1m5kc_ first appeared in SCOP 1.61
  
• d1m5kc_ appears in SCOPe 2.05
  
• d1m5kc_ appears in SCOPe 2.07
  
• d1m5kc_ appears in the current release, SCOPe 2.08